PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.340790.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 196aa    MW: 22672.4 Da    PI: 8.4718
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.340790.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding651.4e-203481148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+++++ +G ++Wk+Ia++ g++R++k+c++rw++yl
   Cucsa.340790.2 34 KGAWTAEEDQKLAQVIAIHGAKRWKSIAAKAGLNRCGKSCRLRWLNYL 81
                     79********************************************97 PP

2Myb_DNA-binding50.83.8e-1687132148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
   Cucsa.340790.2  87 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 132
                      78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.9212985IPR017930Myb domain
SuperFamilySSF466895.35E-3032128IPR009057Homeodomain-like
SMARTSM007175.0E-173383IPR001005SANT/Myb domain
PfamPF002491.6E-193481IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-253588IPR009057Homeodomain-like
CDDcd001672.27E-113681No hitNo description
SMARTSM007171.9E-1586134IPR001005SANT/Myb domain
PROSITE profilePS5129420.43386136IPR017930Myb domain
PfamPF002491.6E-1487132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-2589137IPR009057Homeodomain-like
CDDcd001672.27E-991132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MTEEEEESLK RKVKQVVEGD INEAEILRNG GVNKGAWTAE EDQKLAQVIA IHGAKRWKSI  60
AAKAGLNRCG KSCRLRWLNY LRPNIKRGNI SDQEEDLILR LHKLLGNRWS LIAGRLPGRT  120
DNEIKNYWNS HLSKKMNQQS EKERRKGCKR KVNTESREEE TSQERENSSN LEYDVDNLFD  180
FSNEGPDLEW MSNFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-292913622128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818281e-142LN681828.1 Cucumis melo genomic scaffold, anchoredscaffold00083.
GenBankLN7132581e-142LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008464000.11e-141PREDICTED: transcription factor MYB114-like
RefseqXP_004151013.21e-141PREDICTED: transcription factor MYB114-like isoform X2
SwissprotO496089e-55MYB32_ARATH; Transcription factor MYB32
TrEMBLA0A061GJK07e-85A0A061GJK0_THECC; Myb domain protein 23
STRINGPOPTR_0003s06320.12e-79(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.13e-53myb domain protein 66